Anti DYRK2 pAb (ATL-HPA056902)

Atlas Antibodies

Catalog No.:
ATL-HPA056902-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Gene Name: DYRK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028630: 88%, ENSRNOG00000007821: 55%
Entrez Gene ID: 8445
Uniprot ID: Q92630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPN
Gene Sequence IALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPN
Gene ID - Mouse ENSMUSG00000028630
Gene ID - Rat ENSRNOG00000007821
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYRK2 pAb (ATL-HPA056902)
Datasheet Anti DYRK2 pAb (ATL-HPA056902) Datasheet (External Link)
Vendor Page Anti DYRK2 pAb (ATL-HPA056902) at Atlas Antibodies

Documents & Links for Anti DYRK2 pAb (ATL-HPA056902)
Datasheet Anti DYRK2 pAb (ATL-HPA056902) Datasheet (External Link)
Vendor Page Anti DYRK2 pAb (ATL-HPA056902)