Anti DYRK2 pAb (ATL-HPA027230)

Atlas Antibodies

Catalog No.:
ATL-HPA027230-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Gene Name: DYRK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028630: 98%, ENSRNOG00000007821: 98%
Entrez Gene ID: 8445
Uniprot ID: Q92630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP
Gene Sequence KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP
Gene ID - Mouse ENSMUSG00000028630
Gene ID - Rat ENSRNOG00000007821
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYRK2 pAb (ATL-HPA027230)
Datasheet Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link)
Vendor Page Anti DYRK2 pAb (ATL-HPA027230) at Atlas Antibodies

Documents & Links for Anti DYRK2 pAb (ATL-HPA027230)
Datasheet Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link)
Vendor Page Anti DYRK2 pAb (ATL-HPA027230)
Citations for Anti DYRK2 pAb (ATL-HPA027230) – 2 Found
Mehnert, Martin; Ciuffa, Rodolfo; Frommelt, Fabian; Uliana, Federico; van Drogen, Audrey; Ruminski, Kilian; Gstaiger, Matthias; Aebersold, Ruedi. Multi-layered proteomic analyses decode compositional and functional effects of cancer mutations on kinase complexes. Nature Communications. 2020;11(1):3563.  PubMed
Yoshida, Saishu; Aoki, Katsuhiko; Fujiwara, Ken; Nakakura, Takashi; Kawamura, Akira; Yamada, Kohji; Ono, Masaya; Yogosawa, Satomi; Yoshida, Kiyotsugu. The novel ciliogenesis regulator DYRK2 governs Hedgehog signaling during mouse embryogenesis. Elife. 2020;9( 32758357)  PubMed