Anti DYRK2 pAb (ATL-HPA027230)

Atlas Antibodies

SKU: ATL-HPA027230-25

• 

Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Gene Name: DYRK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028630: 98%, ENSRNOG00000007821: 98%
Entrez Gene ID: 8445
Uniprot ID: Q92630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP
• Gene Sequence: KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP
• Gene ID - Mouse: ENSMUSG00000028630
• Gene ID - Rat: ENSRNOG00000007821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DYRK2 pAb (ATL-HPA027230) – 2 Found

Mehnert, Martin; Ciuffa, Rodolfo; Frommelt, Fabian; Uliana, Federico; van Drogen, Audrey; Ruminski, Kilian; Gstaiger, Matthias; Aebersold, Ruedi. Multi-layered proteomic analyses decode compositional and functional effects of cancer mutations on kinase complexes. Nature Communications. 2020;11(1):3563. 

Yoshida, Saishu; Aoki, Katsuhiko; Fujiwara, Ken; Nakakura, Takashi; Kawamura, Akira; Yamada, Kohji; Ono, Masaya; Yogosawa, Satomi; Yoshida, Kiyotsugu. The novel ciliogenesis regulator DYRK2 governs Hedgehog signaling during mouse embryogenesis. Elife. 2020;9( 32758357)