Anti DYRK2 pAb (ATL-HPA027230)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027230-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DYRK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028630: 98%, ENSRNOG00000007821: 98%
Entrez Gene ID: 8445
Uniprot ID: Q92630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP |
Gene Sequence | KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP |
Gene ID - Mouse | ENSMUSG00000028630 |
Gene ID - Rat | ENSRNOG00000007821 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DYRK2 pAb (ATL-HPA027230) | |
Datasheet | Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link) |
Vendor Page | Anti DYRK2 pAb (ATL-HPA027230) at Atlas Antibodies |
Documents & Links for Anti DYRK2 pAb (ATL-HPA027230) | |
Datasheet | Anti DYRK2 pAb (ATL-HPA027230) Datasheet (External Link) |
Vendor Page | Anti DYRK2 pAb (ATL-HPA027230) |
Citations for Anti DYRK2 pAb (ATL-HPA027230) – 2 Found |
Mehnert, Martin; Ciuffa, Rodolfo; Frommelt, Fabian; Uliana, Federico; van Drogen, Audrey; Ruminski, Kilian; Gstaiger, Matthias; Aebersold, Ruedi. Multi-layered proteomic analyses decode compositional and functional effects of cancer mutations on kinase complexes. Nature Communications. 2020;11(1):3563. PubMed |
Yoshida, Saishu; Aoki, Katsuhiko; Fujiwara, Ken; Nakakura, Takashi; Kawamura, Akira; Yamada, Kohji; Ono, Masaya; Yogosawa, Satomi; Yoshida, Kiyotsugu. The novel ciliogenesis regulator DYRK2 governs Hedgehog signaling during mouse embryogenesis. Elife. 2020;9( 32758357) PubMed |