Anti DYRK1A pAb (ATL-HPA015810)

Atlas Antibodies

SKU: ATL-HPA015810-25

• 
• 

Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Gene Name: DYRK1A
Alternative Gene Name: DYRK, DYRK1, MNBH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022897: 96%, ENSRNOG00000001662: 99%
Entrez Gene ID: 1859
Uniprot ID: Q13627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQ
• Gene Sequence: HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQ
• Gene ID - Mouse: ENSMUSG00000022897
• Gene ID - Rat: ENSRNOG00000001662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.