Anti DYRK1A pAb (ATL-HPA015810)

Atlas Antibodies

Catalog No.:
ATL-HPA015810-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Gene Name: DYRK1A
Alternative Gene Name: DYRK, DYRK1, MNBH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022897: 96%, ENSRNOG00000001662: 99%
Entrez Gene ID: 1859
Uniprot ID: Q13627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQ
Gene Sequence HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQ
Gene ID - Mouse ENSMUSG00000022897
Gene ID - Rat ENSRNOG00000001662
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYRK1A pAb (ATL-HPA015810)
Datasheet Anti DYRK1A pAb (ATL-HPA015810) Datasheet (External Link)
Vendor Page Anti DYRK1A pAb (ATL-HPA015810) at Atlas Antibodies

Documents & Links for Anti DYRK1A pAb (ATL-HPA015810)
Datasheet Anti DYRK1A pAb (ATL-HPA015810) Datasheet (External Link)
Vendor Page Anti DYRK1A pAb (ATL-HPA015810)