Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003938-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DYNLT3
Alternative Gene Name: TCTE1L, TCTEX1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031176: 92%, ENSRNOG00000003611: 89%
Entrez Gene ID: 6990
Uniprot ID: P51808
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE |
| Gene Sequence | DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE |
| Gene ID - Mouse | ENSMUSG00000031176 |
| Gene ID - Rat | ENSRNOG00000003611 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) | |
| Datasheet | Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) | |
| Datasheet | Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) |
| Citations for Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) – 1 Found |
| Aktary, Zackie; Conde-Perez, Alejandro; Rambow, Florian; Di Marco, Mathilde; Amblard, François; Hurbain, Ilse; Raposo, Graça; Delevoye, Cédric; Coscoy, Sylvie; Larue, Lionel. A role for Dynlt3 in melanosome movement, distribution, acidity and transfer. Communications Biology. 2021;4(1):423. PubMed |