Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003938-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dynein, light chain, Tctex-type 3
Gene Name: DYNLT3
Alternative Gene Name: TCTE1L, TCTEX1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031176: 92%, ENSRNOG00000003611: 89%
Entrez Gene ID: 6990
Uniprot ID: P51808
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE
Gene Sequence DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE
Gene ID - Mouse ENSMUSG00000031176
Gene ID - Rat ENSRNOG00000003611
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation)
Datasheet Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation)
Datasheet Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation)
Citations for Anti DYNLT3 pAb (ATL-HPA003938 w/enhanced validation) – 1 Found
Aktary, Zackie; Conde-Perez, Alejandro; Rambow, Florian; Di Marco, Mathilde; Amblard, François; Hurbain, Ilse; Raposo, Graça; Delevoye, Cédric; Coscoy, Sylvie; Larue, Lionel. A role for Dynlt3 in melanosome movement, distribution, acidity and transfer. Communications Biology. 2021;4(1):423.  PubMed