Anti DYNLT1 pAb (ATL-HPA046559)

Atlas Antibodies

SKU: ATL-HPA046559-100

• 
• 

Protein Description: dynein, light chain, Tctex-type 1
Gene Name: DYNLT1
Alternative Gene Name: TCTEL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096255: 94%, ENSRNOG00000018207: 100%
Entrez Gene ID: 6993
Uniprot ID: P63172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASS
• Gene Sequence: AFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASS
• Gene ID - Mouse: ENSMUSG00000096255
• Gene ID - Rat: ENSRNOG00000018207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.