Anti DYNLL1 pAb (ATL-HPA039954)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039954-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: DYNLL1
Alternative Gene Name: DLC1, DLC8, DNCL1, hdlc1, LC8, PIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009013: 100%, ENSRNOG00000011222: 100%
Entrez Gene ID: 8655
Uniprot ID: P63167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV |
Gene Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV |
Gene ID - Mouse | ENSMUSG00000009013 |
Gene ID - Rat | ENSRNOG00000011222 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DYNLL1 pAb (ATL-HPA039954) | |
Datasheet | Anti DYNLL1 pAb (ATL-HPA039954) Datasheet (External Link) |
Vendor Page | Anti DYNLL1 pAb (ATL-HPA039954) at Atlas Antibodies |
Documents & Links for Anti DYNLL1 pAb (ATL-HPA039954) | |
Datasheet | Anti DYNLL1 pAb (ATL-HPA039954) Datasheet (External Link) |
Vendor Page | Anti DYNLL1 pAb (ATL-HPA039954) |
Citations for Anti DYNLL1 pAb (ATL-HPA039954) – 1 Found |
West, Kirk L; Kelliher, Jessica L; Xu, Zhanzhan; An, Liwei; Reed, Megan R; Eoff, Robert L; Wang, Jiadong; Huen, Michael S Y; Leung, Justin W C. LC8/DYNLL1 is a 53BP1 effector and regulates checkpoint activation. Nucleic Acids Research. 2019;47(12):6236-6249. PubMed |