Anti DYNLL1 pAb (ATL-HPA039954)

Atlas Antibodies

Catalog No.:
ATL-HPA039954-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: dynein, light chain, LC8-type 1
Gene Name: DYNLL1
Alternative Gene Name: DLC1, DLC8, DNCL1, hdlc1, LC8, PIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009013: 100%, ENSRNOG00000011222: 100%
Entrez Gene ID: 8655
Uniprot ID: P63167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV
Gene Sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV
Gene ID - Mouse ENSMUSG00000009013
Gene ID - Rat ENSRNOG00000011222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYNLL1 pAb (ATL-HPA039954)
Datasheet Anti DYNLL1 pAb (ATL-HPA039954) Datasheet (External Link)
Vendor Page Anti DYNLL1 pAb (ATL-HPA039954) at Atlas Antibodies

Documents & Links for Anti DYNLL1 pAb (ATL-HPA039954)
Datasheet Anti DYNLL1 pAb (ATL-HPA039954) Datasheet (External Link)
Vendor Page Anti DYNLL1 pAb (ATL-HPA039954)
Citations for Anti DYNLL1 pAb (ATL-HPA039954) – 1 Found
West, Kirk L; Kelliher, Jessica L; Xu, Zhanzhan; An, Liwei; Reed, Megan R; Eoff, Robert L; Wang, Jiadong; Huen, Michael S Y; Leung, Justin W C. LC8/DYNLL1 is a 53BP1 effector and regulates checkpoint activation. Nucleic Acids Research. 2019;47(12):6236-6249.  PubMed