Anti DYNC2LI1 pAb (ATL-HPA062905)

Atlas Antibodies

SKU:
ATL-HPA062905-25
  • Immunohistochemical staining of human fallopian tube shows strong positivity in glandular cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dynein, cytoplasmic 2, light intermediate chain 1
Gene Name: DYNC2LI1
Alternative Gene Name: CGI-60, D2LIC, DKFZP564A033, LIC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024253: 82%, ENSRNOG00000005151: 86%
Entrez Gene ID: 51626
Uniprot ID: Q8TCX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL
Gene Sequence PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL
Gene ID - Mouse ENSMUSG00000024253
Gene ID - Rat ENSRNOG00000005151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DYNC2LI1 pAb (ATL-HPA062905)
Datasheet Anti DYNC2LI1 pAb (ATL-HPA062905) Datasheet (External Link)
Vendor Page Anti DYNC2LI1 pAb (ATL-HPA062905) at Atlas Antibodies

Documents & Links for Anti DYNC2LI1 pAb (ATL-HPA062905)
Datasheet Anti DYNC2LI1 pAb (ATL-HPA062905) Datasheet (External Link)
Vendor Page Anti DYNC2LI1 pAb (ATL-HPA062905)