Anti DYNC2H1 pAb (ATL-HPA039016)

Atlas Antibodies

Catalog No.: ATL-HPA039016-25

Protein Description: dynein, cytoplasmic 2, heavy chain 1
Gene Name: DYNC2H1
Alternative Gene Name: DHC1b, DHC2, DNCH2, DYH1B, hdhc11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047193: 94%, ENSRNOG00000032070: 93%
Entrez Gene ID: 79659
Uniprot ID: Q8NCM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN
• Gene Sequence: DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN
• Gene ID - Mouse: ENSMUSG00000047193
• Gene ID - Rat: ENSRNOG00000032070
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.