Anti DYNC2H1 pAb (ATL-HPA039016)

Atlas Antibodies

Catalog No.:
ATL-HPA039016-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dynein, cytoplasmic 2, heavy chain 1
Gene Name: DYNC2H1
Alternative Gene Name: DHC1b, DHC2, DNCH2, DYH1B, hdhc11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047193: 94%, ENSRNOG00000032070: 93%
Entrez Gene ID: 79659
Uniprot ID: Q8NCM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN
Gene Sequence DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN
Gene ID - Mouse ENSMUSG00000047193
Gene ID - Rat ENSRNOG00000032070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYNC2H1 pAb (ATL-HPA039016)
Datasheet Anti DYNC2H1 pAb (ATL-HPA039016) Datasheet (External Link)
Vendor Page Anti DYNC2H1 pAb (ATL-HPA039016) at Atlas Antibodies

Documents & Links for Anti DYNC2H1 pAb (ATL-HPA039016)
Datasheet Anti DYNC2H1 pAb (ATL-HPA039016) Datasheet (External Link)
Vendor Page Anti DYNC2H1 pAb (ATL-HPA039016)