Anti DYNC2H1 pAb (ATL-HPA039016)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039016-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DYNC2H1
Alternative Gene Name: DHC1b, DHC2, DNCH2, DYH1B, hdhc11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047193: 94%, ENSRNOG00000032070: 93%
Entrez Gene ID: 79659
Uniprot ID: Q8NCM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN |
| Gene Sequence | DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN |
| Gene ID - Mouse | ENSMUSG00000047193 |
| Gene ID - Rat | ENSRNOG00000032070 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DYNC2H1 pAb (ATL-HPA039016) | |
| Datasheet | Anti DYNC2H1 pAb (ATL-HPA039016) Datasheet (External Link) |
| Vendor Page | Anti DYNC2H1 pAb (ATL-HPA039016) at Atlas Antibodies |
| Documents & Links for Anti DYNC2H1 pAb (ATL-HPA039016) | |
| Datasheet | Anti DYNC2H1 pAb (ATL-HPA039016) Datasheet (External Link) |
| Vendor Page | Anti DYNC2H1 pAb (ATL-HPA039016) |