Anti DYNC2H1 pAb (ATL-HPA039015)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039015-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DYNC2H1
Alternative Gene Name: DHC1b, DHC2, DNCH2, DYH1B, hdhc11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047193: 89%, ENSRNOG00000032070: 88%
Entrez Gene ID: 79659
Uniprot ID: Q8NCM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDA |
Gene Sequence | LLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDA |
Gene ID - Mouse | ENSMUSG00000047193 |
Gene ID - Rat | ENSRNOG00000032070 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DYNC2H1 pAb (ATL-HPA039015) | |
Datasheet | Anti DYNC2H1 pAb (ATL-HPA039015) Datasheet (External Link) |
Vendor Page | Anti DYNC2H1 pAb (ATL-HPA039015) at Atlas Antibodies |
Documents & Links for Anti DYNC2H1 pAb (ATL-HPA039015) | |
Datasheet | Anti DYNC2H1 pAb (ATL-HPA039015) Datasheet (External Link) |
Vendor Page | Anti DYNC2H1 pAb (ATL-HPA039015) |