Anti DYNC1I1 pAb (ATL-HPA061689 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061689-25

• 

Protein Description: dynein, cytoplasmic 1, intermediate chain 1
Gene Name: DYNC1I1
Alternative Gene Name: DNCI1, DNCIC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029757: 100%, ENSRNOG00000009700: 98%
Entrez Gene ID: 1780
Uniprot ID: O14576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEE
• Gene Sequence: LQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEE
• Gene ID - Mouse: ENSMUSG00000029757
• Gene ID - Rat: ENSRNOG00000009700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.