Anti DYM pAb (ATL-HPA043551)

Atlas Antibodies

Catalog No.:
ATL-HPA043551-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dymeclin
Gene Name: DYM
Alternative Gene Name: DMC, FLJ20071, SMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035765: 96%, ENSRNOG00000018425: 98%
Entrez Gene ID: 54808
Uniprot ID: Q7RTS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVLEQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR
Gene Sequence MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVLEQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR
Gene ID - Mouse ENSMUSG00000035765
Gene ID - Rat ENSRNOG00000018425
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYM pAb (ATL-HPA043551)
Datasheet Anti DYM pAb (ATL-HPA043551) Datasheet (External Link)
Vendor Page Anti DYM pAb (ATL-HPA043551) at Atlas Antibodies

Documents & Links for Anti DYM pAb (ATL-HPA043551)
Datasheet Anti DYM pAb (ATL-HPA043551) Datasheet (External Link)
Vendor Page Anti DYM pAb (ATL-HPA043551)