Anti DYM pAb (ATL-HPA043551)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043551-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DYM
Alternative Gene Name: DMC, FLJ20071, SMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035765: 96%, ENSRNOG00000018425: 98%
Entrez Gene ID: 54808
Uniprot ID: Q7RTS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVLEQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR |
Gene Sequence | MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVLEQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR |
Gene ID - Mouse | ENSMUSG00000035765 |
Gene ID - Rat | ENSRNOG00000018425 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DYM pAb (ATL-HPA043551) | |
Datasheet | Anti DYM pAb (ATL-HPA043551) Datasheet (External Link) |
Vendor Page | Anti DYM pAb (ATL-HPA043551) at Atlas Antibodies |
Documents & Links for Anti DYM pAb (ATL-HPA043551) | |
Datasheet | Anti DYM pAb (ATL-HPA043551) Datasheet (External Link) |
Vendor Page | Anti DYM pAb (ATL-HPA043551) |