Anti DYDC2 pAb (ATL-HPA038007 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038007-25

• 
• 

Protein Description: DPY30 domain containing 2
Gene Name: DYDC2
Alternative Gene Name: bA36D19.6, MGC16186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021791: 56%, ENSRNOG00000039591: 50%
Entrez Gene ID: 84332
Uniprot ID: Q96IM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKT
• Gene Sequence: LAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKT
• Gene ID - Mouse: ENSMUSG00000021791
• Gene ID - Rat: ENSRNOG00000039591
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.