Anti DYDC1 pAb (ATL-HPA037790)

Atlas Antibodies

Catalog No.:
ATL-HPA037790-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DPY30 domain containing 1
Gene Name: DYDC1
Alternative Gene Name: bA36D19.5, DPY30D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021790: 72%, ENSRNOG00000011165: 79%
Entrez Gene ID: 143241
Uniprot ID: Q8WWB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLA
Gene Sequence VDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLA
Gene ID - Mouse ENSMUSG00000021790
Gene ID - Rat ENSRNOG00000011165
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DYDC1 pAb (ATL-HPA037790)
Datasheet Anti DYDC1 pAb (ATL-HPA037790) Datasheet (External Link)
Vendor Page Anti DYDC1 pAb (ATL-HPA037790) at Atlas Antibodies

Documents & Links for Anti DYDC1 pAb (ATL-HPA037790)
Datasheet Anti DYDC1 pAb (ATL-HPA037790) Datasheet (External Link)
Vendor Page Anti DYDC1 pAb (ATL-HPA037790)