Anti DYDC1 pAb (ATL-HPA037790)

Atlas Antibodies

Catalog No.: ATL-HPA037790-25

Protein Description: DPY30 domain containing 1
Gene Name: DYDC1
Alternative Gene Name: bA36D19.5, DPY30D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021790: 72%, ENSRNOG00000011165: 79%
Entrez Gene ID: 143241
Uniprot ID: Q8WWB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLA
• Gene Sequence: VDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLA
• Gene ID - Mouse: ENSMUSG00000021790
• Gene ID - Rat: ENSRNOG00000011165
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.