Anti DVL3 pAb (ATL-HPA058265)

Atlas Antibodies

Catalog No.:
ATL-HPA058265-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dishevelled segment polarity protein 3
Gene Name: DVL3
Alternative Gene Name: KIAA0208
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003233: 95%, ENSRNOG00000001708: 95%
Entrez Gene ID: 1857
Uniprot ID: Q92997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP
Gene Sequence SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP
Gene ID - Mouse ENSMUSG00000003233
Gene ID - Rat ENSRNOG00000001708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DVL3 pAb (ATL-HPA058265)
Datasheet Anti DVL3 pAb (ATL-HPA058265) Datasheet (External Link)
Vendor Page Anti DVL3 pAb (ATL-HPA058265) at Atlas Antibodies

Documents & Links for Anti DVL3 pAb (ATL-HPA058265)
Datasheet Anti DVL3 pAb (ATL-HPA058265) Datasheet (External Link)
Vendor Page Anti DVL3 pAb (ATL-HPA058265)