Anti DVL2 pAb (ATL-HPA022914)

Atlas Antibodies

SKU:
ATL-HPA022914-25
  • Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DVL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401405).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: dishevelled segment polarity protein 2
Gene Name: DVL2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020888: 91%, ENSRNOG00000017915: 90%
Entrez Gene ID: 1856
Uniprot ID: O14641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVV
Gene Sequence FNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVV
Gene ID - Mouse ENSMUSG00000020888
Gene ID - Rat ENSRNOG00000017915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DVL2 pAb (ATL-HPA022914)
Datasheet Anti DVL2 pAb (ATL-HPA022914) Datasheet (External Link)
Vendor Page Anti DVL2 pAb (ATL-HPA022914) at Atlas Antibodies

Documents & Links for Anti DVL2 pAb (ATL-HPA022914)
Datasheet Anti DVL2 pAb (ATL-HPA022914) Datasheet (External Link)
Vendor Page Anti DVL2 pAb (ATL-HPA022914)