Anti DVL2 pAb (ATL-HPA021611)

Atlas Antibodies

Catalog No.: ATL-HPA021611-25

Protein Description: dishevelled segment polarity protein 2
Gene Name: DVL2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020888: 91%, ENSRNOG00000017915: 95%
Entrez Gene ID: 1856
Uniprot ID: O14641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP
• Gene Sequence: PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP
• Gene ID - Mouse: ENSMUSG00000020888
• Gene ID - Rat: ENSRNOG00000017915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.