Anti DVL1 pAb (ATL-HPA073607)
Atlas Antibodies
- SKU:
- ATL-HPA073607-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DVL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029071: 97%, ENSRNOG00000019423: 100%
Entrez Gene ID: 1855
Uniprot ID: O14640
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS |
Gene Sequence | PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS |
Gene ID - Mouse | ENSMUSG00000029071 |
Gene ID - Rat | ENSRNOG00000019423 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DVL1 pAb (ATL-HPA073607) | |
Datasheet | Anti DVL1 pAb (ATL-HPA073607) Datasheet (External Link) |
Vendor Page | Anti DVL1 pAb (ATL-HPA073607) at Atlas Antibodies |
Documents & Links for Anti DVL1 pAb (ATL-HPA073607) | |
Datasheet | Anti DVL1 pAb (ATL-HPA073607) Datasheet (External Link) |
Vendor Page | Anti DVL1 pAb (ATL-HPA073607) |