Anti DVL1 pAb (ATL-HPA073607)

Atlas Antibodies

SKU:
ATL-HPA073607-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dishevelled segment polarity protein 1
Gene Name: DVL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029071: 97%, ENSRNOG00000019423: 100%
Entrez Gene ID: 1855
Uniprot ID: O14640
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS
Gene Sequence PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS
Gene ID - Mouse ENSMUSG00000029071
Gene ID - Rat ENSRNOG00000019423
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DVL1 pAb (ATL-HPA073607)
Datasheet Anti DVL1 pAb (ATL-HPA073607) Datasheet (External Link)
Vendor Page Anti DVL1 pAb (ATL-HPA073607) at Atlas Antibodies

Documents & Links for Anti DVL1 pAb (ATL-HPA073607)
Datasheet Anti DVL1 pAb (ATL-HPA073607) Datasheet (External Link)
Vendor Page Anti DVL1 pAb (ATL-HPA073607)