Anti DUXA pAb (ATL-HPA059358)

Atlas Antibodies

Catalog No.:
ATL-HPA059358-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: double homeobox A
Gene Name: DUXA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048502: 36%, ENSRNOG00000051929: 36%
Entrez Gene ID: 503835
Uniprot ID: A6NLW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRI
Gene Sequence MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRI
Gene ID - Mouse ENSMUSG00000048502
Gene ID - Rat ENSRNOG00000051929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUXA pAb (ATL-HPA059358)
Datasheet Anti DUXA pAb (ATL-HPA059358) Datasheet (External Link)
Vendor Page Anti DUXA pAb (ATL-HPA059358) at Atlas Antibodies

Documents & Links for Anti DUXA pAb (ATL-HPA059358)
Datasheet Anti DUXA pAb (ATL-HPA059358) Datasheet (External Link)
Vendor Page Anti DUXA pAb (ATL-HPA059358)