Anti DUSP8 pAb (ATL-HPA020071)

Atlas Antibodies

Catalog No.: ATL-HPA020071-25

Protein Description: dual specificity phosphatase 8
Gene Name: DUSP8
Alternative Gene Name: C11orf81, FLJ42958, HB5, HVH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037887: 84%, ENSRNOG00000029394: 84%
Entrez Gene ID: 1850
Uniprot ID: Q13202
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
• Gene Sequence: SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
• Gene ID - Mouse: ENSMUSG00000037887
• Gene ID - Rat: ENSRNOG00000029394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.