Anti DUSP8 pAb (ATL-HPA020071)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020071-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DUSP8
Alternative Gene Name: C11orf81, FLJ42958, HB5, HVH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037887: 84%, ENSRNOG00000029394: 84%
Entrez Gene ID: 1850
Uniprot ID: Q13202
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR |
Gene Sequence | SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR |
Gene ID - Mouse | ENSMUSG00000037887 |
Gene ID - Rat | ENSRNOG00000029394 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DUSP8 pAb (ATL-HPA020071) | |
Datasheet | Anti DUSP8 pAb (ATL-HPA020071) Datasheet (External Link) |
Vendor Page | Anti DUSP8 pAb (ATL-HPA020071) at Atlas Antibodies |
Documents & Links for Anti DUSP8 pAb (ATL-HPA020071) | |
Datasheet | Anti DUSP8 pAb (ATL-HPA020071) Datasheet (External Link) |
Vendor Page | Anti DUSP8 pAb (ATL-HPA020071) |