Anti DUSP8 pAb (ATL-HPA020071)

Atlas Antibodies

Catalog No.:
ATL-HPA020071-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 8
Gene Name: DUSP8
Alternative Gene Name: C11orf81, FLJ42958, HB5, HVH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037887: 84%, ENSRNOG00000029394: 84%
Entrez Gene ID: 1850
Uniprot ID: Q13202
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
Gene Sequence SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
Gene ID - Mouse ENSMUSG00000037887
Gene ID - Rat ENSRNOG00000029394
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUSP8 pAb (ATL-HPA020071)
Datasheet Anti DUSP8 pAb (ATL-HPA020071) Datasheet (External Link)
Vendor Page Anti DUSP8 pAb (ATL-HPA020071) at Atlas Antibodies

Documents & Links for Anti DUSP8 pAb (ATL-HPA020071)
Datasheet Anti DUSP8 pAb (ATL-HPA020071) Datasheet (External Link)
Vendor Page Anti DUSP8 pAb (ATL-HPA020071)