Anti DUSP7 pAb (ATL-HPA073007)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073007-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DUSP7
Alternative Gene Name: MKP-X, PYST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053716: 100%, ENSRNOG00000010789: 100%
Entrez Gene ID: 1849
Uniprot ID: Q16829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET |
| Gene Sequence | AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET |
| Gene ID - Mouse | ENSMUSG00000053716 |
| Gene ID - Rat | ENSRNOG00000010789 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DUSP7 pAb (ATL-HPA073007) | |
| Datasheet | Anti DUSP7 pAb (ATL-HPA073007) Datasheet (External Link) |
| Vendor Page | Anti DUSP7 pAb (ATL-HPA073007) at Atlas Antibodies |
| Documents & Links for Anti DUSP7 pAb (ATL-HPA073007) | |
| Datasheet | Anti DUSP7 pAb (ATL-HPA073007) Datasheet (External Link) |
| Vendor Page | Anti DUSP7 pAb (ATL-HPA073007) |