Anti DUSP7 pAb (ATL-HPA073007)

Atlas Antibodies

Catalog No.:
ATL-HPA073007-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 7
Gene Name: DUSP7
Alternative Gene Name: MKP-X, PYST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053716: 100%, ENSRNOG00000010789: 100%
Entrez Gene ID: 1849
Uniprot ID: Q16829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET
Gene Sequence AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET
Gene ID - Mouse ENSMUSG00000053716
Gene ID - Rat ENSRNOG00000010789
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUSP7 pAb (ATL-HPA073007)
Datasheet Anti DUSP7 pAb (ATL-HPA073007) Datasheet (External Link)
Vendor Page Anti DUSP7 pAb (ATL-HPA073007) at Atlas Antibodies

Documents & Links for Anti DUSP7 pAb (ATL-HPA073007)
Datasheet Anti DUSP7 pAb (ATL-HPA073007) Datasheet (External Link)
Vendor Page Anti DUSP7 pAb (ATL-HPA073007)