Anti DUSP4 pAb (ATL-HPA061967)

Atlas Antibodies

Catalog No.: ATL-HPA061967-25

Protein Description: dual specificity phosphatase 4
Gene Name: DUSP4
Alternative Gene Name: HVH2, MKP-2, TYP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031530: 89%, ENSRNOG00000011921: 89%
Entrez Gene ID: 1846
Uniprot ID: Q13115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS
• Gene Sequence: QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS
• Gene ID - Mouse: ENSMUSG00000031530
• Gene ID - Rat: ENSRNOG00000011921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.