Anti DUSP4 pAb (ATL-HPA061967)

Atlas Antibodies

SKU:
ATL-HPA061967-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 4
Gene Name: DUSP4
Alternative Gene Name: HVH2, MKP-2, TYP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031530: 89%, ENSRNOG00000011921: 89%
Entrez Gene ID: 1846
Uniprot ID: Q13115
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS
Gene Sequence QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS
Gene ID - Mouse ENSMUSG00000031530
Gene ID - Rat ENSRNOG00000011921
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DUSP4 pAb (ATL-HPA061967)
Datasheet Anti DUSP4 pAb (ATL-HPA061967) Datasheet (External Link)
Vendor Page Anti DUSP4 pAb (ATL-HPA061967) at Atlas Antibodies

Documents & Links for Anti DUSP4 pAb (ATL-HPA061967)
Datasheet Anti DUSP4 pAb (ATL-HPA061967) Datasheet (External Link)
Vendor Page Anti DUSP4 pAb (ATL-HPA061967)