Anti DUSP3 pAb (ATL-HPA063616)

Atlas Antibodies

Catalog No.:
ATL-HPA063616-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 3
Gene Name: DUSP3
Alternative Gene Name: VHR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003518: 94%, ENSRNOG00000036798: 88%
Entrez Gene ID: 1845
Uniprot ID: P51452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Gene Sequence LVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Gene ID - Mouse ENSMUSG00000003518
Gene ID - Rat ENSRNOG00000036798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUSP3 pAb (ATL-HPA063616)
Datasheet Anti DUSP3 pAb (ATL-HPA063616) Datasheet (External Link)
Vendor Page Anti DUSP3 pAb (ATL-HPA063616) at Atlas Antibodies

Documents & Links for Anti DUSP3 pAb (ATL-HPA063616)
Datasheet Anti DUSP3 pAb (ATL-HPA063616) Datasheet (External Link)
Vendor Page Anti DUSP3 pAb (ATL-HPA063616)