Anti DUSP27 pAb (ATL-HPA012912)

Atlas Antibodies

Catalog No.:
ATL-HPA012912-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 27 (putative)
Gene Name: DUSP27
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026564: 94%, ENSRNOG00000003722: 94%
Entrez Gene ID: 92235
Uniprot ID: Q5VZP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EALMTVRKKRAIYPNEGFLKQLRELNEKLMEER
Gene Sequence EALMTVRKKRAIYPNEGFLKQLRELNEKLMEER
Gene ID - Mouse ENSMUSG00000026564
Gene ID - Rat ENSRNOG00000003722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUSP27 pAb (ATL-HPA012912)
Datasheet Anti DUSP27 pAb (ATL-HPA012912) Datasheet (External Link)
Vendor Page Anti DUSP27 pAb (ATL-HPA012912) at Atlas Antibodies

Documents & Links for Anti DUSP27 pAb (ATL-HPA012912)
Datasheet Anti DUSP27 pAb (ATL-HPA012912) Datasheet (External Link)
Vendor Page Anti DUSP27 pAb (ATL-HPA012912)