Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018221-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: DUSP26
Alternative Gene Name: DUSP24, MGC1136
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039661: 96%, ENSRNOG00000011518: 97%
Entrez Gene ID: 78986
Uniprot ID: Q9BV47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL |
| Gene Sequence | CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL |
| Gene ID - Mouse | ENSMUSG00000039661 |
| Gene ID - Rat | ENSRNOG00000011518 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) | |
| Datasheet | Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) | |
| Datasheet | Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) |
| Citations for Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) – 1 Found |
| Bourgonje, Annika M; Verrijp, Kiek; Schepens, Jan T G; Navis, Anna C; Piepers, Jolanda A F; Palmen, Chantal B C; van den Eijnden, Monique; Hooft van Huijsduijnen, Rob; Wesseling, Pieter; Leenders, William P J; Hendriks, Wiljan J A J. Comprehensive protein tyrosine phosphatase mRNA profiling identifies new regulators in the progression of glioma. Acta Neuropathologica Communications. 2016;4(1):96. PubMed |