Anti DUSP23 pAb (ATL-HPA028211)

Atlas Antibodies

Catalog No.:
ATL-HPA028211-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 23
Gene Name: DUSP23
Alternative Gene Name: DUSP25, FLJ20442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026544: 99%, ENSRNOG00000022143: 97%
Entrez Gene ID: 54935
Uniprot ID: Q9BVJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Gene Sequence IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Gene ID - Mouse ENSMUSG00000026544
Gene ID - Rat ENSRNOG00000022143
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUSP23 pAb (ATL-HPA028211)
Datasheet Anti DUSP23 pAb (ATL-HPA028211) Datasheet (External Link)
Vendor Page Anti DUSP23 pAb (ATL-HPA028211) at Atlas Antibodies

Documents & Links for Anti DUSP23 pAb (ATL-HPA028211)
Datasheet Anti DUSP23 pAb (ATL-HPA028211) Datasheet (External Link)
Vendor Page Anti DUSP23 pAb (ATL-HPA028211)