Anti DUSP22 pAb (ATL-HPA031394 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031394-25

• 
• 
• 

Protein Description: dual specificity phosphatase 22
Gene Name: DUSP22
Alternative Gene Name: JKAP, JSP1, MKPX, VHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069255: 94%, ENSRNOG00000056376: 91%
Entrez Gene ID: 56940
Uniprot ID: Q9NRW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW
• Gene Sequence: GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW
• Gene ID - Mouse: ENSMUSG00000069255
• Gene ID - Rat: ENSRNOG00000056376
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DUSP22 pAb (ATL-HPA031394 w/enhanced validation) – 1 Found

Mélard, Pierre; Idrissi, Yamina; Andrique, Laetitia; Poglio, Sandrine; Prochazkova-Carlotti, Martina; Berhouet, Sabine; Boucher, Cécile; Laharanne, Elodie; Chevret, Edith; Pham-Ledard, Anne; De Souza Góes, Andréa Carla; Guyonnet-Duperat, Véronique; Bibeyran, Alice; Moreau-Gaudry, François; Vergier, Béatrice; Beylot-Barry, Marie; Merlio, Jean-Philippe; Cappellen, David. Molecular alterations and tumor suppressive function of the DUSP22 (Dual Specificity Phosphatase 22) gene in peripheral T-cell lymphoma subtypes. Oncotarget. 2016;7(42):68734-68748.