Anti DUSP2 pAb (ATL-HPA071920)

Atlas Antibodies

SKU:
ATL-HPA071920-25
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleus & nuclear membrane.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 2
Gene Name: DUSP2
Alternative Gene Name: PAC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027368: 72%, ENSRNOG00000013862: 70%
Entrez Gene ID: 1844
Uniprot ID: Q05923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPTAVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPV
Gene Sequence GPTAVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPV
Gene ID - Mouse ENSMUSG00000027368
Gene ID - Rat ENSRNOG00000013862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DUSP2 pAb (ATL-HPA071920)
Datasheet Anti DUSP2 pAb (ATL-HPA071920) Datasheet (External Link)
Vendor Page Anti DUSP2 pAb (ATL-HPA071920) at Atlas Antibodies

Documents & Links for Anti DUSP2 pAb (ATL-HPA071920)
Datasheet Anti DUSP2 pAb (ATL-HPA071920) Datasheet (External Link)
Vendor Page Anti DUSP2 pAb (ATL-HPA071920)