Anti DUSP19 pAb (ATL-HPA021501 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021501-25
  • Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DUSP19 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408993).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 19
Gene Name: DUSP19
Alternative Gene Name: DUSP17, SKRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027001: 85%, ENSRNOG00000008868: 85%
Entrez Gene ID: 142679
Uniprot ID: Q8WTR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
Gene Sequence QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
Gene ID - Mouse ENSMUSG00000027001
Gene ID - Rat ENSRNOG00000008868
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DUSP19 pAb (ATL-HPA021501 w/enhanced validation)
Datasheet Anti DUSP19 pAb (ATL-HPA021501 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DUSP19 pAb (ATL-HPA021501 w/enhanced validation)