Anti DUSP18 pAb (ATL-HPA051349)

Atlas Antibodies

Catalog No.:
ATL-HPA051349-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 18
Gene Name: DUSP18
Alternative Gene Name: DUSP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047205: 74%, ENSRNOG00000024945: 71%
Entrez Gene ID: 150290
Uniprot ID: Q8NEJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APSCAFPVQFRQPSVSGLSQITKSLYISNGVAATN
Gene Sequence APSCAFPVQFRQPSVSGLSQITKSLYISNGVAATN
Gene ID - Mouse ENSMUSG00000047205
Gene ID - Rat ENSRNOG00000024945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUSP18 pAb (ATL-HPA051349)
Datasheet Anti DUSP18 pAb (ATL-HPA051349) Datasheet (External Link)
Vendor Page Anti DUSP18 pAb (ATL-HPA051349) at Atlas Antibodies

Documents & Links for Anti DUSP18 pAb (ATL-HPA051349)
Datasheet Anti DUSP18 pAb (ATL-HPA051349) Datasheet (External Link)
Vendor Page Anti DUSP18 pAb (ATL-HPA051349)