Anti DUSP16 pAb (ATL-HPA020326)

Atlas Antibodies

SKU:
ATL-HPA020326-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 16
Gene Name: DUSP16
Alternative Gene Name: KIAA1700, MKP-7, MKP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030203: 83%, ENSRNOG00000006628: 81%
Entrez Gene ID: 80824
Uniprot ID: Q9BY84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSETPLSPPCADSATSEAAGQRPVHPASVPSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGFSSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKK
Gene Sequence KSETPLSPPCADSATSEAAGQRPVHPASVPSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGFSSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKK
Gene ID - Mouse ENSMUSG00000030203
Gene ID - Rat ENSRNOG00000006628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DUSP16 pAb (ATL-HPA020326)
Datasheet Anti DUSP16 pAb (ATL-HPA020326) Datasheet (External Link)
Vendor Page Anti DUSP16 pAb (ATL-HPA020326) at Atlas Antibodies

Documents & Links for Anti DUSP16 pAb (ATL-HPA020326)
Datasheet Anti DUSP16 pAb (ATL-HPA020326) Datasheet (External Link)
Vendor Page Anti DUSP16 pAb (ATL-HPA020326)



Citations for Anti DUSP16 pAb (ATL-HPA020326) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed