Anti DUSP14 pAb (ATL-HPA019911 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019911-100
  • Immunohistochemical staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DUSP14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402077).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 14
Gene Name: DUSP14
Alternative Gene Name: MKP-L, MKP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018648: 94%, ENSRNOG00000030091: 96%
Entrez Gene ID: 11072
Uniprot ID: O95147
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS
Gene Sequence LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS
Gene ID - Mouse ENSMUSG00000018648
Gene ID - Rat ENSRNOG00000030091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DUSP14 pAb (ATL-HPA019911 w/enhanced validation)
Datasheet Anti DUSP14 pAb (ATL-HPA019911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DUSP14 pAb (ATL-HPA019911 w/enhanced validation)