Anti DUSP12 pAb (ATL-HPA008840)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008840-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DUSP12
Alternative Gene Name: DUSP1, YVH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026659: 89%, ENSRNOG00000003100: 89%
Entrez Gene ID: 11266
Uniprot ID: Q9UNI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWI |
Gene Sequence | YQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWI |
Gene ID - Mouse | ENSMUSG00000026659 |
Gene ID - Rat | ENSRNOG00000003100 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DUSP12 pAb (ATL-HPA008840) | |
Datasheet | Anti DUSP12 pAb (ATL-HPA008840) Datasheet (External Link) |
Vendor Page | Anti DUSP12 pAb (ATL-HPA008840) at Atlas Antibodies |
Documents & Links for Anti DUSP12 pAb (ATL-HPA008840) | |
Datasheet | Anti DUSP12 pAb (ATL-HPA008840) Datasheet (External Link) |
Vendor Page | Anti DUSP12 pAb (ATL-HPA008840) |