Anti DUSP10 pAb (ATL-HPA016758)

Atlas Antibodies

SKU:
ATL-HPA016758-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity with granular pattern in renal tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 10
Gene Name: DUSP10
Alternative Gene Name: MKP-5, MKP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039384: 98%, ENSRNOG00000004003: 98%
Entrez Gene ID: 11221
Uniprot ID: Q9Y6W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ
Gene Sequence FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ
Gene ID - Mouse ENSMUSG00000039384
Gene ID - Rat ENSRNOG00000004003
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DUSP10 pAb (ATL-HPA016758)
Datasheet Anti DUSP10 pAb (ATL-HPA016758) Datasheet (External Link)
Vendor Page Anti DUSP10 pAb (ATL-HPA016758) at Atlas Antibodies

Documents & Links for Anti DUSP10 pAb (ATL-HPA016758)
Datasheet Anti DUSP10 pAb (ATL-HPA016758) Datasheet (External Link)
Vendor Page Anti DUSP10 pAb (ATL-HPA016758)