Anti DUSP1 pAb (ATL-HPA069577)

Atlas Antibodies

SKU: ATL-HPA069577-25

• 
• 

Protein Description: dual specificity phosphatase 1
Gene Name: DUSP1
Alternative Gene Name: CL100, HVH1, MKP-1, PTPN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024190: 94%, ENSRNOG00000003977: 96%
Entrez Gene ID: 1843
Uniprot ID: P28562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS
• Gene Sequence: QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS
• Gene ID - Mouse: ENSMUSG00000024190
• Gene ID - Rat: ENSRNOG00000003977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.