Anti DUS4L pAb (ATL-HPA044301)

Atlas Antibodies

SKU: ATL-HPA044301-25

• 
• 

Protein Description: dihydrouridine synthase 4-like (S. cerevisiae)
Gene Name: DUS4L
Alternative Gene Name: DUS4, PP35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020648: 83%, ENSRNOG00000008155: 82%
Entrez Gene ID: 11062
Uniprot ID: O95620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGD
• Gene Sequence: ELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGD
• Gene ID - Mouse: ENSMUSG00000020648
• Gene ID - Rat: ENSRNOG00000008155
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.