Anti DUS3L pAb (ATL-HPA041854)

Atlas Antibodies

Catalog No.:
ATL-HPA041854-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dihydrouridine synthase 3-like (S. cerevisiae)
Gene Name: DUS3L
Alternative Gene Name: DUS3, FLJ13896
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007603: 91%, ENSRNOG00000050381: 91%
Entrez Gene ID: 56931
Uniprot ID: Q96G46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQ
Gene Sequence TVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQ
Gene ID - Mouse ENSMUSG00000007603
Gene ID - Rat ENSRNOG00000050381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUS3L pAb (ATL-HPA041854)
Datasheet Anti DUS3L pAb (ATL-HPA041854) Datasheet (External Link)
Vendor Page Anti DUS3L pAb (ATL-HPA041854) at Atlas Antibodies

Documents & Links for Anti DUS3L pAb (ATL-HPA041854)
Datasheet Anti DUS3L pAb (ATL-HPA041854) Datasheet (External Link)
Vendor Page Anti DUS3L pAb (ATL-HPA041854)