Anti DUS1L pAb (ATL-HPA023384)

Atlas Antibodies

Catalog No.:
ATL-HPA023384-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dihydrouridine synthase 1-like (S. cerevisiae)
Gene Name: DUS1L
Alternative Gene Name: DUS1, PP3111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025155: 92%, ENSRNOG00000047905: 90%
Entrez Gene ID: 64118
Uniprot ID: Q6P1R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLRDTGVQGVMSAEGNLHNPALFEGRSPAVWELAEEYLDIVREH
Gene Sequence LTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLRDTGVQGVMSAEGNLHNPALFEGRSPAVWELAEEYLDIVREH
Gene ID - Mouse ENSMUSG00000025155
Gene ID - Rat ENSRNOG00000047905
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUS1L pAb (ATL-HPA023384)
Datasheet Anti DUS1L pAb (ATL-HPA023384) Datasheet (External Link)
Vendor Page Anti DUS1L pAb (ATL-HPA023384) at Atlas Antibodies

Documents & Links for Anti DUS1L pAb (ATL-HPA023384)
Datasheet Anti DUS1L pAb (ATL-HPA023384) Datasheet (External Link)
Vendor Page Anti DUS1L pAb (ATL-HPA023384)