Anti DUS1L pAb (ATL-HPA023384)

Atlas Antibodies

SKU: ATL-HPA023384-25

• 
• 

Protein Description: dihydrouridine synthase 1-like (S. cerevisiae)
Gene Name: DUS1L
Alternative Gene Name: DUS1, PP3111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025155: 92%, ENSRNOG00000047905: 90%
Entrez Gene ID: 64118
Uniprot ID: Q6P1R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLRDTGVQGVMSAEGNLHNPALFEGRSPAVWELAEEYLDIVREH
• Gene Sequence: LTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLRDTGVQGVMSAEGNLHNPALFEGRSPAVWELAEEYLDIVREH
• Gene ID - Mouse: ENSMUSG00000025155
• Gene ID - Rat: ENSRNOG00000047905
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.