Anti DUOXA1 pAb (ATL-HPA041578)

Atlas Antibodies

SKU: ATL-HPA041578-25

• 

Protein Description: dual oxidase maturation factor 1
Gene Name: DUOXA1
Alternative Gene Name: FLJ32334, mol, NIP, NUMBIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027224: 79%, ENSRNOG00000018005: 79%
Entrez Gene ID: 90527
Uniprot ID: Q1HG43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASS
• Gene Sequence: VAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASS
• Gene ID - Mouse: ENSMUSG00000027224
• Gene ID - Rat: ENSRNOG00000018005
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.