Anti DUOXA1 pAb (ATL-HPA041578)

Atlas Antibodies

Catalog No.:
ATL-HPA041578-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dual oxidase maturation factor 1
Gene Name: DUOXA1
Alternative Gene Name: FLJ32334, mol, NIP, NUMBIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027224: 79%, ENSRNOG00000018005: 79%
Entrez Gene ID: 90527
Uniprot ID: Q1HG43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASS
Gene Sequence VAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASS
Gene ID - Mouse ENSMUSG00000027224
Gene ID - Rat ENSRNOG00000018005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUOXA1 pAb (ATL-HPA041578)
Datasheet Anti DUOXA1 pAb (ATL-HPA041578) Datasheet (External Link)
Vendor Page Anti DUOXA1 pAb (ATL-HPA041578) at Atlas Antibodies

Documents & Links for Anti DUOXA1 pAb (ATL-HPA041578)
Datasheet Anti DUOXA1 pAb (ATL-HPA041578) Datasheet (External Link)
Vendor Page Anti DUOXA1 pAb (ATL-HPA041578)