Anti DTYMK pAb (ATL-HPA042719)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042719-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DTYMK
Alternative Gene Name: CDC8, TMPK, TYMK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026281: 87%, ENSRNOG00000018904: 87%
Entrez Gene ID: 1841
Uniprot ID: P23919
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVA |
Gene Sequence | RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVA |
Gene ID - Mouse | ENSMUSG00000026281 |
Gene ID - Rat | ENSRNOG00000018904 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DTYMK pAb (ATL-HPA042719) | |
Datasheet | Anti DTYMK pAb (ATL-HPA042719) Datasheet (External Link) |
Vendor Page | Anti DTYMK pAb (ATL-HPA042719) at Atlas Antibodies |
Documents & Links for Anti DTYMK pAb (ATL-HPA042719) | |
Datasheet | Anti DTYMK pAb (ATL-HPA042719) Datasheet (External Link) |
Vendor Page | Anti DTYMK pAb (ATL-HPA042719) |