Anti DTYMK pAb (ATL-HPA042593)

Atlas Antibodies

Catalog No.:
ATL-HPA042593-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: deoxythymidylate kinase (thymidylate kinase)
Gene Name: DTYMK
Alternative Gene Name: CDC8, TMPK, TYMK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026281: 68%, ENSRNOG00000018904: 71%
Entrez Gene ID: 1841
Uniprot ID: P23919
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTAT
Gene Sequence DLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTAT
Gene ID - Mouse ENSMUSG00000026281
Gene ID - Rat ENSRNOG00000018904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DTYMK pAb (ATL-HPA042593)
Datasheet Anti DTYMK pAb (ATL-HPA042593) Datasheet (External Link)
Vendor Page Anti DTYMK pAb (ATL-HPA042593) at Atlas Antibodies

Documents & Links for Anti DTYMK pAb (ATL-HPA042593)
Datasheet Anti DTYMK pAb (ATL-HPA042593) Datasheet (External Link)
Vendor Page Anti DTYMK pAb (ATL-HPA042593)