Anti DTX4 pAb (ATL-HPA056760)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056760-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DTX4
Alternative Gene Name: KIAA0937, RNF155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039982: 71%, ENSRNOG00000021086: 73%
Entrez Gene ID: 23220
Uniprot ID: Q9Y2E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLP |
Gene Sequence | TSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLP |
Gene ID - Mouse | ENSMUSG00000039982 |
Gene ID - Rat | ENSRNOG00000021086 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DTX4 pAb (ATL-HPA056760) | |
Datasheet | Anti DTX4 pAb (ATL-HPA056760) Datasheet (External Link) |
Vendor Page | Anti DTX4 pAb (ATL-HPA056760) at Atlas Antibodies |
Documents & Links for Anti DTX4 pAb (ATL-HPA056760) | |
Datasheet | Anti DTX4 pAb (ATL-HPA056760) Datasheet (External Link) |
Vendor Page | Anti DTX4 pAb (ATL-HPA056760) |