Anti DTX4 pAb (ATL-HPA056760)

Atlas Antibodies

Catalog No.:
ATL-HPA056760-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: deltex 4, E3 ubiquitin ligase
Gene Name: DTX4
Alternative Gene Name: KIAA0937, RNF155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039982: 71%, ENSRNOG00000021086: 73%
Entrez Gene ID: 23220
Uniprot ID: Q9Y2E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLP
Gene Sequence TSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLP
Gene ID - Mouse ENSMUSG00000039982
Gene ID - Rat ENSRNOG00000021086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DTX4 pAb (ATL-HPA056760)
Datasheet Anti DTX4 pAb (ATL-HPA056760) Datasheet (External Link)
Vendor Page Anti DTX4 pAb (ATL-HPA056760) at Atlas Antibodies

Documents & Links for Anti DTX4 pAb (ATL-HPA056760)
Datasheet Anti DTX4 pAb (ATL-HPA056760) Datasheet (External Link)
Vendor Page Anti DTX4 pAb (ATL-HPA056760)