Anti DTX3 pAb (ATL-HPA059654)

Atlas Antibodies

Catalog No.: ATL-HPA059654-25

Protein Description: deltex 3, E3 ubiquitin ligase
Gene Name: DTX3
Alternative Gene Name: FLJ34766, RNF154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040415: 96%, ENSRNOG00000005129: 96%
Entrez Gene ID: 196403
Uniprot ID: Q8N9I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMC
• Gene Sequence: LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMC
• Gene ID - Mouse: ENSMUSG00000040415
• Gene ID - Rat: ENSRNOG00000005129
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.