Anti DTX2 pAb (ATL-HPA042931)

Atlas Antibodies

SKU: ATL-HPA042931-25

• 
• 

Protein Description: deltex 2, E3 ubiquitin ligase
Gene Name: DTX2
Alternative Gene Name: KIAA1528, RNF58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004947: 74%, ENSRNOG00000001432: 75%
Entrez Gene ID: 113878
Uniprot ID: Q86UW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSL
• Gene Sequence: YPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSL
• Gene ID - Mouse: ENSMUSG00000004947
• Gene ID - Rat: ENSRNOG00000001432
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.