Anti DTWD1 pAb (ATL-HPA042214)

Atlas Antibodies

Catalog No.: ATL-HPA042214-25

Protein Description: DTW domain containing 1
Gene Name: DTWD1
Alternative Gene Name: MDS009, MGC111207
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023330: 87%, ENSRNOG00000009593: 90%
Entrez Gene ID: 56986
Uniprot ID: Q8N5C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC
• Gene Sequence: LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC
• Gene ID - Mouse: ENSMUSG00000023330
• Gene ID - Rat: ENSRNOG00000009593
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DTWD1 pAb (ATL-HPA042214) – 1 Found

Donovan, Katherine A; An, Jian; Nowak, Radosław P; Yuan, Jingting C; Fink, Emma C; Berry, Bethany C; Ebert, Benjamin L; Fischer, Eric S. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. Elife. 2018;7( 30067223)