Anti DTWD1 pAb (ATL-HPA042214)

Atlas Antibodies

Catalog No.:
ATL-HPA042214-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DTW domain containing 1
Gene Name: DTWD1
Alternative Gene Name: MDS009, MGC111207
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023330: 87%, ENSRNOG00000009593: 90%
Entrez Gene ID: 56986
Uniprot ID: Q8N5C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC
Gene Sequence LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC
Gene ID - Mouse ENSMUSG00000023330
Gene ID - Rat ENSRNOG00000009593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DTWD1 pAb (ATL-HPA042214)
Datasheet Anti DTWD1 pAb (ATL-HPA042214) Datasheet (External Link)
Vendor Page Anti DTWD1 pAb (ATL-HPA042214) at Atlas Antibodies

Documents & Links for Anti DTWD1 pAb (ATL-HPA042214)
Datasheet Anti DTWD1 pAb (ATL-HPA042214) Datasheet (External Link)
Vendor Page Anti DTWD1 pAb (ATL-HPA042214)
Citations for Anti DTWD1 pAb (ATL-HPA042214) – 1 Found
Donovan, Katherine A; An, Jian; Nowak, Radosław P; Yuan, Jingting C; Fink, Emma C; Berry, Bethany C; Ebert, Benjamin L; Fischer, Eric S. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. Elife. 2018;7( 30067223)  PubMed