Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029615-100
  • Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and luminal membrane positivity in urothelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DTNBP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403167).
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: dystrobrevin binding protein 1
Gene Name: DTNBP1
Alternative Gene Name: BLOC1S8, DBND, Dysbindin, HPS7, My031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057531: 92%, ENSRNOG00000048719: 90%
Entrez Gene ID: 84062
Uniprot ID: Q96EV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKK
Gene Sequence GLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKK
Gene ID - Mouse ENSMUSG00000057531
Gene ID - Rat ENSRNOG00000048719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation)
Datasheet Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation)