Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029615-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: DTNBP1
Alternative Gene Name: BLOC1S8, DBND, Dysbindin, HPS7, My031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057531: 92%, ENSRNOG00000048719: 90%
Entrez Gene ID: 84062
Uniprot ID: Q96EV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKK |
Gene Sequence | GLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKK |
Gene ID - Mouse | ENSMUSG00000057531 |
Gene ID - Rat | ENSRNOG00000048719 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation) | |
Datasheet | Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation) | |
Datasheet | Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DTNBP1 pAb (ATL-HPA029615 w/enhanced validation) |