Anti DTNBP1 pAb (ATL-HPA028053)

Atlas Antibodies

Catalog No.:
ATL-HPA028053-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: dystrobrevin binding protein 1
Gene Name: DTNBP1
Alternative Gene Name: BLOC1S8, DBND, Dysbindin, HPS7, My031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057531: 76%, ENSRNOG00000048719: 73%
Entrez Gene ID: 84062
Uniprot ID: Q96EV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK
Gene Sequence LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK
Gene ID - Mouse ENSMUSG00000057531
Gene ID - Rat ENSRNOG00000048719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053)
Datasheet Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link)
Vendor Page Anti DTNBP1 pAb (ATL-HPA028053) at Atlas Antibodies

Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053)
Datasheet Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link)
Vendor Page Anti DTNBP1 pAb (ATL-HPA028053)
Citations for Anti DTNBP1 pAb (ATL-HPA028053) – 1 Found
Samardžija, Bobana; Pavešić Radonja, Aristea; Zaharija, Beti; Bergman, Mihaela; Renner, Éva; Palkovits, Miklós; Rubeša, Gordana; Bradshaw, Nicholas J. Protein Aggregation of NPAS3, Implicated in Mental Illness, Is Not Limited to the V304I Mutation. Journal Of Personalized Medicine. 2021;11(11)  PubMed