Anti DTNBP1 pAb (ATL-HPA028053)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028053-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: DTNBP1
Alternative Gene Name: BLOC1S8, DBND, Dysbindin, HPS7, My031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057531: 76%, ENSRNOG00000048719: 73%
Entrez Gene ID: 84062
Uniprot ID: Q96EV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Gene Sequence | LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Gene ID - Mouse | ENSMUSG00000057531 |
| Gene ID - Rat | ENSRNOG00000048719 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053) | |
| Datasheet | Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link) |
| Vendor Page | Anti DTNBP1 pAb (ATL-HPA028053) at Atlas Antibodies |
| Documents & Links for Anti DTNBP1 pAb (ATL-HPA028053) | |
| Datasheet | Anti DTNBP1 pAb (ATL-HPA028053) Datasheet (External Link) |
| Vendor Page | Anti DTNBP1 pAb (ATL-HPA028053) |
| Citations for Anti DTNBP1 pAb (ATL-HPA028053) – 1 Found |
| Samardžija, Bobana; Pavešić Radonja, Aristea; Zaharija, Beti; Bergman, Mihaela; Renner, Éva; Palkovits, Miklós; Rubeša, Gordana; Bradshaw, Nicholas J. Protein Aggregation of NPAS3, Implicated in Mental Illness, Is Not Limited to the V304I Mutation. Journal Of Personalized Medicine. 2021;11(11) PubMed |