Anti DTNB pAb (ATL-HPA061357)

Atlas Antibodies

Catalog No.:
ATL-HPA061357-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dystrobrevin, beta
Gene Name: DTNB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071454: 91%, ENSRNOG00000011914: 93%
Entrez Gene ID: 1838
Uniprot ID: O60941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQ
Gene Sequence MIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQ
Gene ID - Mouse ENSMUSG00000071454
Gene ID - Rat ENSRNOG00000011914
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DTNB pAb (ATL-HPA061357)
Datasheet Anti DTNB pAb (ATL-HPA061357) Datasheet (External Link)
Vendor Page Anti DTNB pAb (ATL-HPA061357) at Atlas Antibodies

Documents & Links for Anti DTNB pAb (ATL-HPA061357)
Datasheet Anti DTNB pAb (ATL-HPA061357) Datasheet (External Link)
Vendor Page Anti DTNB pAb (ATL-HPA061357)