Anti DTL pAb (ATL-HPA032031)

Atlas Antibodies

SKU: ATL-HPA032031-25

• 

Protein Description: denticleless E3 ubiquitin protein ligase homolog (Drosophila)
Gene Name: DTL
Alternative Gene Name: CDT2, DCAF2, L2DTL, RAMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037474: 85%, ENSRNOG00000004195: 86%
Entrez Gene ID: 51514
Uniprot ID: Q9NZJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA
• Gene Sequence: AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA
• Gene ID - Mouse: ENSMUSG00000037474
• Gene ID - Rat: ENSRNOG00000004195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.