Anti DTL pAb (ATL-HPA032031)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032031-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DTL
Alternative Gene Name: CDT2, DCAF2, L2DTL, RAMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037474: 85%, ENSRNOG00000004195: 86%
Entrez Gene ID: 51514
Uniprot ID: Q9NZJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA |
| Gene Sequence | AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA |
| Gene ID - Mouse | ENSMUSG00000037474 |
| Gene ID - Rat | ENSRNOG00000004195 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DTL pAb (ATL-HPA032031) | |
| Datasheet | Anti DTL pAb (ATL-HPA032031) Datasheet (External Link) |
| Vendor Page | Anti DTL pAb (ATL-HPA032031) at Atlas Antibodies |
| Documents & Links for Anti DTL pAb (ATL-HPA032031) | |
| Datasheet | Anti DTL pAb (ATL-HPA032031) Datasheet (External Link) |
| Vendor Page | Anti DTL pAb (ATL-HPA032031) |