Anti DTL pAb (ATL-HPA032031)

Atlas Antibodies

Catalog No.:
ATL-HPA032031-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: denticleless E3 ubiquitin protein ligase homolog (Drosophila)
Gene Name: DTL
Alternative Gene Name: CDT2, DCAF2, L2DTL, RAMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037474: 85%, ENSRNOG00000004195: 86%
Entrez Gene ID: 51514
Uniprot ID: Q9NZJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA
Gene Sequence AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA
Gene ID - Mouse ENSMUSG00000037474
Gene ID - Rat ENSRNOG00000004195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DTL pAb (ATL-HPA032031)
Datasheet Anti DTL pAb (ATL-HPA032031) Datasheet (External Link)
Vendor Page Anti DTL pAb (ATL-HPA032031) at Atlas Antibodies

Documents & Links for Anti DTL pAb (ATL-HPA032031)
Datasheet Anti DTL pAb (ATL-HPA032031) Datasheet (External Link)
Vendor Page Anti DTL pAb (ATL-HPA032031)