Anti DTD1 pAb (ATL-HPA040981 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040981-100
  • Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DTD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409024).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: D-tyrosyl-tRNA deacylase 1
Gene Name: DTD1
Alternative Gene Name: bA379J5.3, bA555E18.1, C20orf88, DUEB, HARS2, MGC119131, MGC41905, pqn-68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027430: 94%, ENSRNOG00000008746: 96%
Entrez Gene ID: 92675
Uniprot ID: Q8TEA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Gene Sequence SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Gene ID - Mouse ENSMUSG00000027430
Gene ID - Rat ENSRNOG00000008746
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DTD1 pAb (ATL-HPA040981 w/enhanced validation)
Datasheet Anti DTD1 pAb (ATL-HPA040981 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DTD1 pAb (ATL-HPA040981 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DTD1 pAb (ATL-HPA040981 w/enhanced validation)
Datasheet Anti DTD1 pAb (ATL-HPA040981 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DTD1 pAb (ATL-HPA040981 w/enhanced validation)