Anti DSP pAb (ATL-HPA054950 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA054950-25

Protein Description: desmoplakin
Gene Name: DSP
Alternative Gene Name: DPI, DPII, KPPS2, PPKS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054889: 91%, ENSRNOG00000013928: 89%
Entrez Gene ID: 1832
Uniprot ID: P15924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW
• Gene Sequence: RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW
• Gene ID - Mouse: ENSMUSG00000054889
• Gene ID - Rat: ENSRNOG00000013928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) – 1 Found

Strauss, Philipp; Rivedal, Mariell; Scherer, Andreas; Eikrem, Øystein; Nakken, Sigrid; Beisland, Christian; Bostad, Leif; Flatberg, Arnar; Skandalou, Eleni; Beisvåg, Vidar; Furriol, Jessica; Marti, Hans-Peter. A multiomics disease progression signature of low-risk ccRCC. Scientific Reports. 2022;12(1):13503.