Anti DSP pAb (ATL-HPA054950 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054950-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DSP
Alternative Gene Name: DPI, DPII, KPPS2, PPKS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054889: 91%, ENSRNOG00000013928: 89%
Entrez Gene ID: 1832
Uniprot ID: P15924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW |
| Gene Sequence | RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW |
| Gene ID - Mouse | ENSMUSG00000054889 |
| Gene ID - Rat | ENSRNOG00000013928 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) | |
| Datasheet | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) | |
| Datasheet | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) |
| Citations for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) – 1 Found |
| Strauss, Philipp; Rivedal, Mariell; Scherer, Andreas; Eikrem, Øystein; Nakken, Sigrid; Beisland, Christian; Bostad, Leif; Flatberg, Arnar; Skandalou, Eleni; Beisvåg, Vidar; Furriol, Jessica; Marti, Hans-Peter. A multiomics disease progression signature of low-risk ccRCC. Scientific Reports. 2022;12(1):13503. PubMed |