Anti DSP pAb (ATL-HPA054950 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054950-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DSP
Alternative Gene Name: DPI, DPII, KPPS2, PPKS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054889: 91%, ENSRNOG00000013928: 89%
Entrez Gene ID: 1832
Uniprot ID: P15924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW |
Gene Sequence | RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW |
Gene ID - Mouse | ENSMUSG00000054889 |
Gene ID - Rat | ENSRNOG00000013928 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) | |
Datasheet | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) | |
Datasheet | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DSP pAb (ATL-HPA054950 w/enhanced validation) |
Citations for Anti DSP pAb (ATL-HPA054950 w/enhanced validation) – 1 Found |
Strauss, Philipp; Rivedal, Mariell; Scherer, Andreas; Eikrem, Øystein; Nakken, Sigrid; Beisland, Christian; Bostad, Leif; Flatberg, Arnar; Skandalou, Eleni; Beisvåg, Vidar; Furriol, Jessica; Marti, Hans-Peter. A multiomics disease progression signature of low-risk ccRCC. Scientific Reports. 2022;12(1):13503. PubMed |